DPCstruct | MC46640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 232 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 64.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07946 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3C1G6 | 1-239 | MRSVLLPIALLLCGVCMVKAYEDNTLEDDDFAEFEQFDAEDDVPVTDFHEETKDVPVQKPFESDKDIEDEILVEDEDNEFEHFQDPE… |
| V5G418 | 632-847 | LEKAISASVITMAGVFKNLFGGESPSPAPAKVDDDFADFGGAPDPAPASIIPEPSAATAAAQLGAQTPGAGPVPFTKWYRVWERTSP… |
| A0A815X6V2 | 1-264 | None |
| A0A139XIV4 | 114-341 | None |
| G5BE93 | 49-285 | None |
| A0A1V8U1I2 | 553-773 | None |
| A0A4S8K811 | 482-706 | None |
| A0A2R7WVM5 | 1-218 | None |
| G7DSD7 | 1-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.