DPCstruct | MC46639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 198 ± 31 aa |
| Standard deviation of domain lengths | 31.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1D6C5 | 22-190 | DTYVPPPSKRGPPQGGDMAYIKENIDRQSNIYQDIRRVGGVEDVVWDVYARASPQLSFWFVGKVALCSTVSLSQALSRQWNLMEEHA… |
| R1D7B5 | 42-236 | VVAKAAKRKAAAGKRKPAKPAAFDLKKAMLVAMRAHQDLWRLDPQRECSRDVYVRADGGSRFFFAGKAVGAAGRCDAASAVLLQKRA… |
| B8BS02 | 1-187 | None |
| A0A6T9NL14 | 8-186 | None |
| A0A7S4NDP3 | 48-242 | None |
| A0A7S0L5H3 | 54-263 | None |
| A0A1E7ERY0 | 31-316 | None |
| A0A0M0KB06 | 139-320 | None |
| D8LD44 | 128-297 | None |
| A0A5J4YVY6 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.