DPCstruct | MC46638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1D6B2 | 1-122 | MPPRKKAGASSQFDASEVMQPVQALRGRMDAAGSSRKRTLEEVGVSGVSKEVQHMGAEDVSAEIEALCMRAVASIMRGDGFSYMMPS… |
| A0A445BGL5 | 4-130 | SSKKRRRTNTDDLPFKNKLKLDSTILQILKDFSTSSSSSSSSSSSKTLTLQDLSLPFSCREVSDLSLSSVQSNIESLVLRIAHSILS… |
| A0A7J7KWY5 | 10-132 | None |
| A0A0L9T9E8 | 358-480 | None |
| A0A498K7L3 | 375-495 | None |
| A0A4D8ZZR8 | 92-221 | None |
| A0A7S3A1Z0 | 48-189 | None |
| A0A2I0IUW9 | 18-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.