DPCstruct | MC46625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2NGZ1 | 1-84 | EFSQRRALKTPFIGCGDVLSYVEAEEHLQSHGVDSIMIGRGALMKPWLFTEMADRRHWDISASERLDLVRDFVGFGLDHWGADA |
| A0A1B0GKI2 | 386-458 | IGNGDILSFEDYLEAREAAPHISGTMIGRGALIKPWLFQEIKEQRHMDPSATERFDMMKKFVNYGLEHWGSDT |
| X6PFV6 | 56-141 | None |
| T1H094 | 60-132 | None |
| A0A2J7ZSV4 | 38-132 | None |
| A0A6A4WYB3 | 20-106 | None |
| A0A7S4DAY5 | 41-143 | None |
| A0A1B0BZT4 | 794-866 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.