DPCstruct | MC4662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 121 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9S4F3 | 116-217 | SNDLDQICLHMQALRSTLLEDAPFHLLIPTWDRLVLSEPLHFPKELQPLCIEGVTYDSQPLVTMNVPRAPRYLLRGVKNEVESEESA… |
| X0BDF6 | 1-129 | MRADREALIATTDYGRAAVFHLVIPAYYPLVMDHPIAFADELLPLVITGGRHRGADLVWFAIRRDPREERLHLNFVGLLPQNQGNLA… |
| A0A6A6U887 | 1-148 | None |
| J4KQM4 | 120-247 | None |
| N4VTK2 | 61-204 | None |
| A0A2T3ZVQ6 | 217-341 | None |
| N4WFY2 | 109-203 | None |
| N4WZV6 | 5-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.