DPCstruct | MC46619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 183 ± 30 aa |
| Standard deviation of domain lengths | 30.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433Q4C2 | 14-174 | QFCPYDDVLGFGHSAGVSSLVIPGSGEPNFDSLEANPFQTKKQRQESEVHSLLDKIQSDMITLDPTFIGKIDRGSKEVLEKEAKEAR… |
| A0A402G1N0 | 93-244 | GAACQEVVQVYKDILVCPSPKPYICHALPRPAHALRFCPFEDVLGVGHEEGFASLLVPGAGEPNFDAMEINPFRSRKQRQEWEVKAL… |
| A0A146IGH0 | 337-600 | None |
| G3NET7 | 266-469 | None |
| A0A816Y7E4 | 326-521 | None |
| A0A7S2SQA1 | 1-149 | None |
| A0A7R9JDY0 | 70-274 | None |
| A0A1S8A5L2 | 1-128 | None |
| A0A7S1GJH5 | 1-178 | None |
| A0A7S3DYL9 | 28-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.