DPCstruct | MC46618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 16.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.59 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | PF09725- CL0251 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433Q4B3 | 26-126 | MAQTDHSKRIFRNEFNGSDAYTRHKKLINDYFLFYPPKPSERTVAGKTELDVLKENHEFIRNPDEDGSSVTWEQRVAKKYYDKLFKE… |
| D7EIU5 | 5-106 | RSRMRYMNPYDIHKAIINEYVLKQPGDTKLLQRDASKDRTDIDVLKANHRFLWDDSIPDTWEAQFAKKYYDKLFKEYCIADLTYYKE… |
| A0A368G8X2 | 1-146 | None |
| A0A0F7SPQ4 | 30-143 | None |
| D8UG85 | 527-658 | None |
| S4R6B7 | 40-144 | None |
| A0A835NS53 | 69-202 | None |
| A0A151TPR9 | 16-112 | None |
| A0A369S9F5 | 82-207 | None |
| A0A1C7NIV2 | 8-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.