DPCstruct | MC46614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 196 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 65.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YVS4 | 23-222 | LACGDGRKSGGSPRGAPVTSASSSLIICRNKHWRHISSFHGAWLQIPTEILETIANINYNTLRPRPIDPAILFDLIKIRKNVDEAAD… |
| A0A395IUJ5 | 1-188 | MPKAKVTKPIQQPSTSALIICRNKHWRYISSFHGPWLQLPPEVLEVLANNNYTLPRPRPIDPAVFFDILKIRQLVDDATNLAVRAAS… |
| A0A5M9JDU6 | 24-236 | None |
| R0IP92 | 43-218 | None |
| A0A5C6GEB1 | 221-404 | None |
| U4L922 | 14-200 | None |
| A0A395MZ59 | 516-725 | None |
| R1G520 | 1-207 | None |
| A0A6A5ZTP8 | 447-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.