DPCstruct | MC4661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 269 ± 38 aa |
| Standard deviation of domain lengths | 37.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0BB15 | 2-258 | APVFGKMNESESVTTADEQERIISYLNRKQAEIRLLNEKEAEIVIPTETSNEIFTADPCLDLIDRLNWIHQTTEAWRFVSCELCFII… |
| A0A420NKZ5 | 3-237 | QHIAILDRLNSRAGFSDDKNLLRAKCKLWELGRTLEHWTQIGCQLCYVRGDMGLDHQLDDCTAAGSKVAQRLCGWLEARDLDRYIEA… |
| A0A0J9WDK9 | 310-552 | None |
| W9NHH5 | 351-643 | None |
| A0A0F7ZHU1 | 106-494 | None |
| A0A6M7Z9E3 | 79-343 | None |
| A0A0F7ZRL0 | 735-1017 | None |
| A0A420N687 | 39-324 | None |
| A0A0B4GVF0 | 2-273 | None |
| A0A014PI63 | 283-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.