DPCstruct | MC46609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 217 ± 21 aa |
| Standard deviation of domain lengths | 21.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183SPW1 | 761-953 | LKLADCPPFPVDILKKLTLDVLIDIVNTGGHVRDPFGGSFEHALLPLLRIVNHLLVMGSLDAKDLSTVLCLLNPKAFPLAQNWRTKI… |
| A0A0N4WID4 | 1-216 | MGFRFSRDEEMKLLPPAINFDALKAYVMSAMESATRHAVMNCRDLIGGDNRNHFEPLMKLFDSLLVIGVFDDTELEALLQMIHPAAF… |
| A0A3P7LTF3 | 130-308 | None |
| A0A1S3T525 | 261-489 | None |
| A0A183NXT8 | 218-448 | None |
| L9KZI0 | 495-723 | None |
| A0A2I0LIQ5 | 637-880 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.