DPCstruct | MC4660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 276 ± 64 aa |
| Standard deviation of domain lengths | 63.89 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1WDN3 | 285-551 | MSDFLGHGRSEQETREFFYPSKGSQKVDQSCRRRPNLLLNLDRESYWQVYEHVVQSRQLSFPDVHRILGLSEQDGKILSGVINHVVD… |
| A0A428SGS9 | 1-217 | MEVRRLFYPGQPSDESNLTRRQGLLSELNDDAYTRVYRRIVDRPGLVFPDVQKLLKTTKEEGRIMMQVLTHVVAWLNPSPTIIMDKR… |
| A0A7J6IDK0 | 309-577 | None |
| A0A179F4Q6 | 196-439 | None |
| X0KYH7 | 78-348 | None |
| A0A0J9W800 | 124-431 | None |
| A0A0J9W4D9 | 40-467 | None |
| M1WDL6 | 209-499 | None |
| A0A7R8ARM1 | 78-484 | None |
| A0A430MAS1 | 231-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.