DPCstruct | MC466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.80 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | CL0260- PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VTK0 | 39-164 | ETDPDVKRIYDTALGLEGLIRNAGVHACAVIMSSEPLTDAIPVWKRAQDGAIITGWDYPSCEAIGLLKMDFLGLRNLTVIGDAIENI… |
| A0A0B0HPK4 | 1-113 | MRGAEIDRLAAGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDTSAEWRTTHFDFHSIHDNLLKLDILGHDDPTVIRMLQDL… |
| A0A380E526 | 14-112 | None |
| A0A210VQX5 | 451-556 | None |
| A0A3C1R7L9 | 2-95 | None |
| A0A2Z4PCF7 | 18-123 | None |
| A0A7C7RQG5 | 1-95 | None |
| A0A1Q9TZI2 | 2-97 | None |
| A0A0G1XS63 | 54-154 | None |
| A0A090S807 | 6-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.