DPCstruct | MC4659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 341 ± 65 aa |
| Standard deviation of domain lengths | 64.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.99 |
| Pfam Score | 88.58 |
| Assigned Pfam label(s) | CL0229- PF04968- CL0202- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287R429 | 282-536 | DPFWVTINHPLLPTSIAPSKIATDGSSTIQYLEKTFPLSRANREMLQKADYDIQVWCILLDDQVPFRMNWPLHSDMQINGIEVRVVN… |
| X0BAQ8 | 2-337 | LFHACYGAFPTDQHSGAGFRSSQLKTLTFKPSPFYQMKASISDIQVCDVTSRRHTISYAIRLEDSSSLRNCVDNPSYRVLIVCAGGC… |
| A0A094HWH8 | 572-958 | None |
| A0A1I8IPQ1 | 209-536 | None |
| A0A6I8PF85 | 16-383 | None |
| A0A6I8PHL9 | 12-429 | None |
| A0A0V0QQU5 | 48-416 | None |
| A0A0K0E9S2 | 8-420 | None |
| W9WG04 | 639-1023 | None |
| A0A7R8XAG2 | 374-741 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.