DPCstruct | MC46589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 442 ± 78 aa |
| Standard deviation of domain lengths | 77.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1IA40 | 48-442 | QQMCPRESLKDHVLPLVRATIANGFIVATSERRRLNSLVDVLLRVDSAALVPLAGSSLLILYPLEQAQKEWKFLATAGTEPSQPAPL… |
| A0A5C2SHI2 | 26-513 | KWTGDLFMDVSREKAERVCSVLLSDSTDPLPNGLRFSICLTGDSIRLSALFHLASLPNFLLASTRVQQFAKVGPAEETDADAIKQIG… |
| A0A4S8M8T4 | 528-1167 | None |
| A0A0B7NQ11 | 390-802 | None |
| A0A1C7NK21 | 453-967 | None |
| A0A4S9NBF1 | 463-902 | None |
| T5AQX5 | 82-451 | None |
| A0A4V5NFR7 | 2-291 | None |
| A0A3N4IJ64 | 320-681 | None |
| M1VU97 | 472-957 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.