DPCstruct | MC46588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 453 ± 92 aa |
| Standard deviation of domain lengths | 91.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1I3U8 | 2-510 | LSDLQNVIDTYYELNDPSERWNSAQVLVQYLTQRGLDDVRGNVQAALGLLAWSEQPNVMWDAGYLEAFVHCVGIMSQRTMETREYKN… |
| M7TQZ1 | 94-450 | LKSPLWEQVSPITRQRLERAYLDLVSKQNSVNNRLESFEFPALFSGVASSATMYKDVKFAIWRRSFNRMKQFVLNYYKTSFGNWPPK… |
| A0A0C9LMU5 | 172-659 | None |
| A0A168EIB7 | 346-897 | None |
| A0A4S2MLJ1 | 239-687 | None |
| R1EYI0 | 2-589 | None |
| A0A395IGQ0 | 85-699 | None |
| A0A395IJ13 | 190-797 | None |
| C9SEG6 | 142-624 | None |
| C9SQ56 | 1-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.