DPCstruct | MC46580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8ZST8 | 1-84 | MDDRRPDPSAVRLSASLENDQIDAKYGFERYKATEERLGWLINMHPTEVMDADKRLRSAVDYFFVQENGDRFKATLPFEPYFYV |
| A0A2I0JBN6 | 1-98 | MNGDSRKRDRRDLRSFKRQKKLLRSAEEELESKLGFDLFSEGEKKLGWLLTFAPSSWEDPETSKVYSCIDLYFVTQDGTSFKSKYKF… |
| A0A183BKA3 | 1-94 | None |
| A0A7J7JJZ3 | 1-111 | None |
| A0A819KWN2 | 1-111 | None |
| A0A6G3MHH5 | 4-98 | None |
| A0A183CM50 | 1-85 | None |
| E9QAP5 | 1-111 | None |
| Q9VCN1 | 2-100 | None |
| A0A3L6UXK2 | 18-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.