DPCstruct | MC4658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 308 ± 57 aa |
| Standard deviation of domain lengths | 57.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 27.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9QAR2 | 77-385 | YCADNFAAFHSALRCADVEAMERCYQLANPPLHLERKISCHCPADKPHKHHRSIDDVLECLAIGSVPIDRCIKATRWLLSKGCEANE… |
| X0B6V4 | 46-339 | TRELPKYNGYEKGCQPIDELLESVYLGKVPTEKGIDASKRLLESHFDMKEQRDQAWYDVNTHCDHFPDFLITMLNKSPDRVYTEGIC… |
| A0A5Q3FCV1 | 74-389 | None |
| A0A2H3HQV0 | 38-283 | None |
| A0A6M7YHU5 | 62-395 | None |
| A0A420SME5 | 186-421 | None |
| A0A0J9WAR8 | 1-412 | None |
| A0A0J9VIE5 | 118-399 | None |
| A0A365MRM0 | 18-292 | None |
| A0A420SPA0 | 2-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.