DPCstruct | MC4657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20594 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A350M638 | 20-122 | KIYIPKDLDDVFIELRKMLPQDVQTKMKNGTEQEMIEYHFSLGMWMRNHWGLWQKSRLAKYFHGIGVQHPDDMSGIIIKSFWRHLNN… |
| A0A4Q3FWP8 | 93-200 | YLAKLDKDTLNGVYIPKDLQDCFVQLDKMLSTKSKTEIKGLKNKSETIKYHHSLGMTLRNSWGLWGGSRLQKYFLDKKLNHPDEMSA… |
| B8F9A0 | 33-137 | None |
| A0A5B8BQW1 | 20-124 | None |
| M1YWU0 | 36-146 | None |
| A0A7V3WM31 | 28-137 | None |
| A0A2U3B0I6 | 6-89 | None |
| A0A811BKJ0 | 19-112 | None |
| A0A7C1PWV1 | 52-173 | None |
| B4RF61 | 150-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.