DPCstruct | MC46569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 222 ± 29 aa |
| Standard deviation of domain lengths | 28.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0220- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GAU3 | 147-349 | EEEKHSAEIQRRMHPRSTEDFEILYNELENWRAHETRRIEEAGLPERERLEALAQLLHKETKLLQTIDRLKIGATKENRERRIARML… |
| A0A2P6TL98 | 153-344 | RDAQRQLEAYVAQQAAAAAAAAEALRQKEAQRRMQPRTQVDFLVLYDELAVWWGQEQAKIAAAQGLTGQERQAARRALLAKETKLLQ… |
| A0A2P6NG32 | 458-695 | None |
| A0A7S1QQ64 | 209-464 | None |
| C1E0T6 | 347-585 | None |
| A0A3Q1G8Y6 | 280-510 | None |
| A0A1X7T298 | 215-479 | None |
| A0A7R9IY89 | 465-704 | None |
| A0A812WGR8 | 370-615 | None |
| A0A3Q4HB78 | 168-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.