DPCstruct | MC46564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 470 ± 62 aa |
| Standard deviation of domain lengths | 61.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 91.03 |
| Assigned Pfam label(s) | PF12825- PF12828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4ZHL2 | 42-478 | AEDLARAFEDAWREWAYGGLVDDMFDHVKGTEDVEGHSPMMKAALDYTIIHLATFAHHIFILSPEGQYLLKLIENINSLIPYKMIKQ… |
| A0A316VNM3 | 375-928 | ARKETHRVRRDWQAFKEHTIESEAGLEETMAYLQVSNIRNLPPRYRNAEEWARMHAAYLFHNLFVTSPAADSIFGVVKGIHALFPYW… |
| A0A0A8L040 | 501-918 | None |
| A0A5N5QTH1 | 586-1118 | None |
| A0A0E9NNX4 | 188-664 | None |
| A0A180G6M3 | 2-402 | None |
| I4YAX9 | 423-963 | None |
| C4JHX3 | 745-1153 | None |
| A0A2S5BCI9 | 736-1211 | None |
| R9AFI6 | 329-789 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.