DPCstruct | MC4656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0BMV3 | 6-103 | ICESADKVLQNFINSLDDVETSHHRMDSQKIKCNFGQLGICCKLCANGPCRITPKAPKGVCGANADTIVARNFLRAVAAGSGCYIHV… |
| A0A1Z5HQM3 | 16-145 | AERVMDRKNRVRTIDPAAREMLEKAAQDNVITAFDRLVAQQPQCQFGYRGICCRFCMMGPCRIKADEGPASKGICGASAWTIVARSV… |
| A0A0P8C4U3 | 2-98 | None |
| A0A4Z0R3L6 | 10-152 | None |
| A0A1V5GIX9 | 84-185 | None |
| A0A6N3FIZ4 | 99-185 | None |
| T0EB82 | 4-91 | None |
| A0A3D2XTG8 | 1-120 | None |
| A0A450T5J2 | 12-129 | None |
| A0A7C4S2G6 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.