DPCstruct | MC46558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03849 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553N464 | 63-193 | LQCKNLHEYLKELSPEILDRLYNHPATCLAVYRELPSLAKNYVMRMLFLDHPLPQAAVALWVKKDSQKDHDQCVTVLMGLRLWHSQQ… |
| Q4N732 | 26-142 | FNYLKELDEQVWERLFRVKACLVALFRSLGELEKLIIYRLLYIEQSISEKPLRLWMRSHSIGDLKHSLTLLQSYKIINVLENTTNDE… |
| A0A5J4WBA1 | 141-265 | None |
| A0A0F7SUA4 | 324-445 | None |
| W7AT92 | 1-115 | None |
| A0A6A5DW76 | 750-869 | None |
| A0A6A6L8C3 | 2-109 | None |
| B0EME9 | 5-133 | None |
| F2UT33 | 11-117 | None |
| A0A433Q9D2 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.