DPCstruct | MC46553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 184 ± 35 aa |
| Standard deviation of domain lengths | 35.03 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.57 |
| Pfam Score | 87.21 |
| Assigned Pfam label(s) | CL0063- CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2L4S0 | 15-210 | PGVPEGAITRRHILHDHEREDGLAGFISIIGGKITPYRHLAEEVVTLACRKLRLERRARPKERFEPLPGGVPFPPREVEEMAGALGV… |
| A0A6J4WYU0 | 2-138 | AEDCVGHAATLAGLEAKACVTKRLNIHGYHKSPQKFGSLAIYGSDAPAIQDLLRADTLRQKLIHPALPALCGEVVWAVRFEAARTID… |
| W1NIE1 | 298-501 | None |
| A0A1I8IQQ7 | 198-411 | None |
| E9GAW1 | 53-263 | None |
| A0A259K546 | 1-168 | None |
| A0A1B0C2A1 | 1-120 | None |
| A0A1Q7D511 | 2-156 | None |
| A0A7S4URR5 | 8-262 | None |
| A0A7V3GU20 | 37-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.