DPCstruct | MC4655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 919 |
|---|---|
| Mean domain length (aa) | 200 ± 39 aa |
| Standard deviation of domain lengths | 39.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.71 |
| Pfam Score | 79.70 |
| Assigned Pfam label(s) | PF00057- PF02140- CL0083- CL0168- PF14008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3GZU6 | 11-174 | RIAVYTGLDFFGSDLDSARTADLVGCAALCLERGEGCRAFTFNADERVVRGPNCFLKSDSRSADGNAVAMSGVMLRRSDPDPAPIVV… |
| A0A2C9LE46 | 49-229 | INSSIYTNVYSKFYTMDYTLNSAEVFTTKADKRLPNVNSNEMCARACTTNPDFRCESFEICDDGYCNLRKTHLIQAKPSDLTNATSC… |
| A0A6G0XI56 | 63-264 | None |
| A0A6G0XBI2 | 271-490 | None |
| A0A318YH04 | 8-311 | None |
| A0A812JEC9 | 141-279 | None |
| A0A1J9R6F7 | 52-265 | None |
| A0A7M5V157 | 215-474 | None |
| A0A7M5UX94 | 32-308 | None |
| A0A1J9RSV2 | 145-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.