DPCstruct | MC46543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 350 ± 92 aa |
| Standard deviation of domain lengths | 92.21 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381I529 | 11-340 | INDLLAEQYANAFKAKEEGRPVGWSTSVFPQELAEVFDLNVLYPENQAAGVAAKKGSLELCEIAESKGYSIDLCAYARTNFGLLENG… |
| A0A847FAG4 | 55-440 | AKKIIIPNMAPHATVLASAMQAFGVDAEVLPEADKDDLIYAEEVTSGTECLPYRVTLGSFLTYLKTHPDSKGVQGFMSGSYGPCRLG… |
| A0A843PD90 | 293-575 | None |
| A0A3N5X3H5 | 60-448 | None |
| A0A7V2UFW5 | 196-561 | None |
| A0A367Z9K2 | 11-433 | None |
| A0A1M7TW58 | 2-372 | None |
| A0A522UJC1 | 2-208 | None |
| A0A7Y4UCI7 | 14-257 | None |
| A0A2H0T9F5 | 166-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.