DPCstruct | MC4654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 168 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0KN66 | 2-171 | VVETLMMELSWQIKQAEKQQRERENEYRKIKTGVDYGWLVSYPKQSYDISPGERLQLEDMCTKIHPSYCGPVILRFRQVVAEYEPEA… |
| A0A835U016 | 1-161 | MAVWNEPPNRISQRNPTEMVVETLMMELSWQMKQAEKQQRERENEYRKIKTGVDYGWLVSYPKHSYDISPGERLQLEDMCTKIHPSY… |
| A0A7I8W1N6 | 20-159 | None |
| A0A553Q8R7 | 60-262 | None |
| A0A1I7S358 | 1-175 | None |
| A0A1W0X9Q9 | 23-196 | None |
| A0A7I8VSZ0 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.