DPCstruct | MC46537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 439 ± 57 aa |
| Standard deviation of domain lengths | 56.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6A3V5 | 435-833 | SPVKDIENGITDTGVLLRTFLPYATANSRQTLHSYTGNGLVLDARVSCQAPLITQFNGTEHYSQLQGTVETTKNSTMLQTIYPTSFD… |
| A0A0J9WAS2 | 44-428 | QRTACFPPTFVNTSIQWDTGERTGINGLYLNATFAVENQTDFLGKELSKTVQVYCKLHNIWNDTKTSRNWPTALCNELAMVEVSSKN… |
| A0A4T0VLB1 | 1-395 | None |
| A0A6A6B2I0 | 13-506 | None |
| X0J1A7 | 5-388 | None |
| A0A366Q689 | 522-909 | None |
| A0A2V1DYV7 | 162-622 | None |
| A0A0F0ILK8 | 73-500 | None |
| A0A6A6UIA9 | 7-408 | None |
| W9NUL8 | 118-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.