DPCstruct | MC46536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 215 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9W3B1 | 1-219 | MTNNGRSFSISSGVSSNSNSSNSDVRSVSISTGTNSTGLLHKRPVKPMLVLFTQNRQGDKFSFVTVQIDDETNTNPERCNCRRSGRD… |
| K2RAV0 | 403-582 | ATFSTMEGSVSSTIFTGTNISRLDTGSGTVGVRMDRPEMPKLVLFLESKKTGSLSFLSVAMNENTFINEQACDCRLPRSRCAIAVIE… |
| A0A4T0VHP6 | 637-859 | None |
| A0A4R8RML7 | 274-483 | None |
| A0A0A2V379 | 1-202 | None |
| R8BM21 | 644-860 | None |
| A0A428NME5 | 219-422 | None |
| A0A420RVY6 | 232-450 | None |
| A0A1C1CID5 | 248-486 | None |
| A0A428SDL3 | 421-640 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.