DPCstruct | MC46533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 74.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5A550 | 582-678 | IDFTVRLDDIVEVRWNVDALQVHLVMRKHGATKAKQDSLPRGDVMAAFKRERTIRRFLEFCRDRNLRTVDVTADEMDIRWGEMQSER… |
| X0HM34 | 210-308 | IDFHVNLAEIEEMEWSIEALRVHIIMKKDAGELAADGKPRGDVMASFPRARTMRRFLFFCRERGMKMAKREPEQLNNLWDSMVSEQL… |
| X0GPI0 | 348-444 | None |
| A0A4Q2V1Y1 | 474-545 | None |
| W9ZXA8 | 803-902 | None |
| X0GP13 | 248-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.