DPCstruct | MC4653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804R3Y4 | 1-119 | MRQRTMVLSNYLHGKGCFRRPSMEIEYGLCAVSLDHEAVKTWIYPTNVEGREYQKYMVEKAMFTNTLIALPTGLGKTFIAAVVMYNY… |
| A0A0C9SP03 | 3-90 | LKVDMLEAKHWIYPLNQPKRDYQFNIVKRCLFENTLVALPTGLGKTFIAGVVMLNFYRWFPEGKVVFVAPTKPLVAQQIDACHRTCGI |
| G4V6T5 | 79-182 | None |
| A0A453HID3 | 106-229 | None |
| Q8BGE5 | 14-150 | None |
| A0A6N2MBD9 | 78-203 | None |
| A0A671VAZ7 | 5-131 | None |
| K3ZN59 | 280-386 | None |
| A0A2G8S722 | 189-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.