DPCstruct | MC46526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 121 ± 22 aa |
| Standard deviation of domain lengths | 21.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 92.49 |
| Assigned Pfam label(s) | PF12338- PF00101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0W7T0 | 1-111 | MQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV… |
| A0A0E0MLJ3 | 98-230 | NGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDAT… |
| A0A0A2AQ53 | 1-88 | None |
| A0A7S0GM48 | 71-211 | None |
| A0A4S4EY92 | 12-146 | None |
| A0A835AHA5 | 210-349 | None |
| Q39749 | 21-171 | None |
| A0A5N6PM22 | 368-482 | None |
| A0A1V0GSV8 | 7-105 | None |
| A0A2W4Z4E5 | 222-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.