DPCstruct | MC46524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 253 ± 29 aa |
| Standard deviation of domain lengths | 28.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0M950 | 2-227 | EIAKRIDRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASLLKSVGRGLDIGTLIEVRRAQLA… |
| Q0IWS0 | 201-427 | MEIAKRIDRNAGVGQQQAFEKLIFVTNLVFRDAYEYLLPWKRLFGVHESQIDDVMRESAKSLYASLLKSIGRGLDIGTLIEVRRSQL… |
| A0A5N5J4M5 | 15-232 | None |
| D8R4X9 | 190-485 | None |
| A0A7S3E0J0 | 296-544 | None |
| A0A452YL92 | 124-401 | None |
| A0A836XQM1 | 160-449 | None |
| V4T1J7 | 2-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.