DPCstruct | MC46519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 447 ± 53 aa |
| Standard deviation of domain lengths | 53.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5DBU6 | 246-712 | DPSTDNSDENKGQQKVQQKSSWTQRLPFVWDLVLHNLIESTLETETLGNDKKRSRTSSKSSKKRKVDEHTSTSTNRITLNEFWTVVV… |
| F2SKQ4 | 1-380 | MYLGGLFAAASSEERKYWGFLVFMKVLNEAPMEVASQIFTQNFMRCLMNQLAVEDRYLHKIAVKAAKSIQARTSKEPDFAYPALCGL… |
| W8BW28 | 307-801 | None |
| A0A3R7MKG7 | 13-399 | None |
| A0A034VLD7 | 312-816 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.