DPCstruct | MC46516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 330 ± 77 aa |
| Standard deviation of domain lengths | 77.45 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6SN73 | 2-374 | GNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQ… |
| A0A845EVE0 | 7-209 | KICVLGNGMVIDPKAFVEEVAYLHERNVSTDNLRISNRAHVILPYHLKLDILQEEEKGVNKIGTTKKGIGPAYMDKAARMGIRIADL… |
| A0A2A2K597 | 7-316 | None |
| A0A843E3F9 | 3-276 | None |
| A0A0J9V3A4 | 3-244 | None |
| T2RDE1 | 1-210 | None |
| A0A7F8K8H2 | 28-400 | None |
| A0A447PVW2 | 175-359 | None |
| A0A067BY54 | 54-426 | None |
| M2TI68 | 503-903 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.