DPCstruct | MC46515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A663MYJ7 | 1-87 | TWGYKYWINDIYYNQQTFMNYTRDALKEIAEQLDAMSRMAWENRIALDMILAEKGGVCVMLGNRCCTFIPNNIAPDGTTTKALQRLT |
| A0A3B4E8G3 | 8-95 | SYVIKRLHYNLAKFINHSVEAVNGINSELTALRLVAEQNRLALDLVKEGGVCHVIGTECCTFVQANDSLEGNITVCILLINAQSWVHD |
| A0A4W5L4Z6 | 204-285 | None |
| A0A667Y4X6 | 445-530 | None |
| A0A673N8G1 | 318-421 | None |
| A0A3P8QD48 | 228-311 | None |
| A0A3P8Q4G3 | 291-374 | None |
| A0A674P252 | 1-81 | None |
| A0A6P7HFS2 | 306-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.