DPCstruct | MC46513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 147 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8PVK8 | 11-138 | MVPVHVGDGSTWTPEAFRLRGTRLERFEPAVVAASLTAKDQVRFRQAVDNGELKQAQQLLHNVVGDRHVLDRIEVSPDSVREIGDAV… |
| A0A1V1P677 | 7-159 | KTIISCYIKTIAPVHIGCGEIYEPTSFIINENKQELIAFDRLTFAATLTNPEKQTLKQICLKGNIGSIVALNNFIRNKHVDGQSVAL… |
| A0A1G0F081 | 9-159 | None |
| A0A661SKY7 | 2-162 | None |
| A0A1S9CNR1 | 1-136 | None |
| A0A6N1YAD8 | 7-167 | None |
| A0A496RFS4 | 10-138 | None |
| A0A1G7HLK2 | 166-317 | None |
| A0A4Q1CZ94 | 1-165 | None |
| A0A661JD06 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.