DPCstruct | MC4651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 5.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265- PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FBV8 | 87-180 | MVVDPWGAIVAQCSERVDMCFAEIDTAYVAELRKMQPVFEHRRSDLYTLHVNEIDNDNSPMKFSEFTIAPESIFYRSSLCFAFVNLK… |
| A0A2C9LAY1 | 12-105 | QCSEGVGLCLAEIDLDYVAKVRSEMPVWQHRRTDLYGRVTALHSDSSIISPEEQDSYQFGHVTIKSSQVFYRTLLSLAFVNNKPVLP… |
| A0A6A4WMU1 | 182-293 | None |
| A0A814MPY4 | 83-182 | None |
| A0A815JN25 | 1-90 | None |
| A0A6V7WT27 | 74-171 | None |
| A0A0D8XT84 | 7-104 | None |
| A0A819NQ21 | 1-99 | None |
| A0A814C681 | 78-181 | None |
| A0A817D4I4 | 379-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.