DPCstruct | MC46508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1NY41 | 16-164 | DSLIENTLESQRELENKTNRQFTDYAIPSATFIAELFRATAILSGLKENESILYDIGYHVGKIIYIVDSCIDIKEDFEKDQFNALIA… |
| A0A829Z7B9 | 2-106 | GLICAYKDDEWYDELYELGFYLGRFIYFIDAYEDIEDDLKKGNYNPLKKMYQTKQFDERCKDILELMISEATMAFERLPIIENAEII… |
| A0A396N5T8 | 8-161 | None |
| A0A847C940 | 1-135 | None |
| R6H9C9 | 101-217 | None |
| R5SPR6 | 14-153 | None |
| A0A7X9CYE4 | 20-156 | None |
| A0A6B1QIL3 | 2-122 | None |
| R6H6L2 | 2-139 | None |
| A0A2V2D4L9 | 107-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.