DPCstruct | MC46505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 9.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1NS64 | 1-101 | MIIPPSNIQELYQRLLTDNSIPKNLHFYYKKWFRYYWDFCHQYKATVNDQNSLPLFKKKLFEKNQNKYQVQQAVDAILIYYRHINKL… |
| A0A1G1EA60 | 1-80 | MLAIPSALQAQFEEYLRNKEIPSSLQGTYKKWLRYYLDFCQKYHFPPIPKESLPHFIHKLQEKKQTKERQEQAVMAITVY |
| A0A661SIJ3 | 27-130 | None |
| G2E462 | 1-99 | None |
| A0A7V3UGS3 | 27-104 | None |
| A0A7C2TJ85 | 1-107 | None |
| A0A3D5YDD3 | 1-107 | None |
| A0A1W9X9S7 | 1-101 | None |
| A0A194AFN4 | 1-95 | None |
| A0A6J4X9C7 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.