DPCstruct | MC46501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 185 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420NER1 | 1-177 | MAYFLPPQGLQQLWGRILAAVLQPGLQDFRDPELFVEAKGTKLLFKYPDAPSDLLAVRENFDCKLHHVLDFSHICSDRLYVDVSNET… |
| X0BBP9 | 1-152 | MDMHQYLPQEYLPAIWHHMTQNTEHADLGVFRGMFIVLSAKNIKLEAKSSTFQECRTKITAHLHQVLDWSKADLSNTWVDVGLENTA… |
| A0A2V1CWW0 | 311-517 | None |
| X0KGS5 | 42-250 | None |
| A0A420M8B0 | 327-517 | None |
| A0A6A5SID8 | 141-295 | None |
| X0GW87 | 86-276 | None |
| A0A420NYC0 | 165-340 | None |
| W9HHB8 | 1-201 | None |
| X0BD29 | 64-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.