DPCstruct | MC4650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 259 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0258- CL0600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2KHS5 | 692-938 | KGRLREALRHVLSISRLGNQHMQSEQPWVLLKGSEDDKQRGATAIGLCCQLVALLCALLAPYVPDTTRKLRGQLNVDAEKLRLNPEN… |
| A0A2C9L9S0 | 1-252 | MQVTKPWVLSKGSPEEIKRAGSVIALCANVACLLSVLLQPYMPTTSAVIQQQLQAPASVNYIGGEFVPMLQPGHQIGQPSPLFQKLE… |
| A0A6L5CMN7 | 509-778 | None |
| A0A2S2QV39 | 25-261 | None |
| A0A2W1BGJ2 | 125-387 | None |
| A0A811W6W2 | 85-351 | None |
| A0A5E4QGT5 | 284-559 | None |
| A0A5E4M0R5 | 475-735 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.