DPCstruct | MC465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8HWE2 | 1-111 | MPADALPPLGRVLMTHVGCAVFETITGEVVEPALAARFYPGVAATTGTLVWATRRRPTHDELVRAWPAREEAGPAETARGWWQPTIT… |
| F0LFT5 | 145-250 | YPVPVDDMPPFERAIGTHAGVVIFTETQGELADPEIVTAVYFQPPSDEEYVWAAWRPGSLEELVTTWPARTPPGEREAARGWWVPNL… |
| A0A543NU13 | 188-297 | None |
| A0A1S7SJT2 | 159-273 | None |
| A0A3S2G553 | 113-218 | None |
| A0A6J4HI01 | 48-160 | None |
| A0A4R3GLE4 | 147-237 | None |
| A0A0T6XPS6 | 120-227 | None |
| A0A1M3BY13 | 161-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.