DPCstruct | MC46499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 188 ± 33 aa |
| Standard deviation of domain lengths | 32.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16483 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S6XLM6 | 1-179 | MSLQIDLVNSTSSPTVYAYVTGLDLNANNAWLLLRSDGQTLYHPTSPSQPLTPLAEDCAIPLGSPGATRSIRVPRLVGGRIWFSLDK… |
| A0A420N560 | 70-226 | GLDAGPLPIKLVNNFNKSSVKAYITGLDAGGKVFFALHNGKLIYPDARGSRLPVKVTNDVAISLPSKGESLSITLPSFIRSGRIYFS… |
| A0A1M5T8I7 | 758-914 | None |
| A0A413RAL1 | 722-895 | None |
| A0A0W0Z5L2 | 9-198 | None |
| A0A840SIQ9 | 536-718 | None |
| A0A395IPI5 | 2-181 | None |
| A0A2V1CQZ7 | 79-241 | None |
| A0A2M9JYV4 | 61-249 | None |
| A0A161XNH7 | 17-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.