DPCstruct | MC46498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 315 ± 32 aa |
| Standard deviation of domain lengths | 32.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8A8V9 | 438-736 | VQKCRRLLGAWYESATFEHPLFDGQERERHADPGDPANSIIVFTNLMYIYYHTACVTLCNYRIFNGLSIARSPTSDLVTEDVAAEGS… |
| A0A420MZM9 | 1-304 | MAITEQDGHQVDMPKSSVLMFANMIWIYYHSARVTLCNFELLLGMTTHSLVSYENTQLQVATIERVRIGLWDAATHITNRLEQLLDL… |
| W9NH50 | 774-1094 | None |
| A0A0P7BDS0 | 486-812 | None |
| A0A2H3U719 | 236-478 | None |
| A0A1S9RKE2 | 688-984 | None |
| A0A366RXP8 | 279-633 | None |
| A0A1V6RB87 | 2-346 | None |
| A0A0C4DJE9 | 1-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.