DPCstruct | MC46497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 128 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8A6B1 | 1-111 | MADPLEHKVVETSPPILSPSTLLADAQQLQEERLFRHFRGWLFSERAKDTSSWTWDYGYDIQRAHERRWVCKLCIHQRVPQPKNFTH… |
| A0A420MUZ5 | 19-139 | STAFSLLDSPDLGSSETKGGAADDASFSVDYIGYEGIDWNRLSGYSIRKHQRRPRTGWVWEHGFDIEKDGSGHRFWLCKMCHQKKAT… |
| A0A1B8A644 | 1-130 | None |
| A0A1B8A632 | 384-498 | None |
| A0A1B8A5C5 | 56-175 | None |
| A0A1B8A4L0 | 1-124 | None |
| A0A1B8A4G7 | 3-91 | None |
| A0A1B8A3R7 | 3-93 | None |
| A0A2H3UFA4 | 1-118 | None |
| W9NC92 | 64-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.