DPCstruct | MC46481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Standard deviation of domain lengths | 24.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446MDC8 | 108-274 | TSKVSRTGSGLGAAGMAGYGRAVEILDTLGCLMTTLSPDGGFISRTTKGTQISILAFEVANTILKGASVMQSLSEDSVTYFKQVVLP… |
| A0A2P6SKI8 | 1-146 | MVAKLRFPRLMRTRRRKQKAVVGIFAFEVASVMSKLVHLWAFLSSKQVDRLRKKISDSVGIKKLVSHDDDFIRGLIPGELFENMVPL… |
| A0A4Y7J5I6 | 131-269 | None |
| A0A7J0GFQ9 | 128-267 | None |
| A0A1D6EAI4 | 1-207 | None |
| A0A1B6PQG1 | 260-420 | None |
| A0A7I4F4L6 | 78-282 | None |
| A0A6P5MYY5 | 41-194 | None |
| A0A453T7Z7 | 22-160 | None |
| A0A6A2XRT8 | 6-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.