DPCstruct | MC4648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 91 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812JKD9 | 5-90 | LDLWLIHPEAEMCEAFRDRFQELPHVTVMECRFEDLPPHDCFVTAANSFGIMNAGIDAAVVNFHGYDLMKRIQHRILDLYLGEQPL |
| A0A2C9L7N0 | 13-102 | DGIVTYHLRDINAELVVEWQHAFSEYGDSVKISQGDIFNDAPAADAIVSPANSFGFMDGGIDWIYSKYFGWQMQNRLQNVIREDYHG… |
| A0A167TRP9 | 15-121 | None |
| A0A098LHL7 | 3-84 | None |
| A0A2Z3HE63 | 1-83 | None |
| A0A2P6P0K7 | 303-398 | None |
| A0A5B9P6Q3 | 1-69 | None |
| A0A2U3EQJ5 | 10-113 | None |
| A0A836SGA4 | 1-64 | None |
| A0A6A6TNX1 | 9-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.