DPCstruct | MC46478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7WNL9 | 1-82 | MLNTRPQILTRATDGDAMTLVFYPDTGCLRFAASRGVVRHELRPPHSWLAIASASREVRGGTHAISESLSTLLHDFCVKRSQ |
| A0A1H4GLI3 | 2-87 | ITTQPCTATRGTGGDAITVAFYPDTGCLRFSDAQGTCLHELLPPHSWFAVSSFARNDQGGAAPGPQTLDILLIEFTTGTRFTNARI |
| A0A158KTE5 | 1-76 | None |
| A0A1H1IW19 | 1-92 | None |
| A0A1N6I0F8 | 1-83 | None |
| A0A2N7VYI4 | 1-97 | None |
| Q13I93 | 30-115 | None |
| A0A2Z5ML91 | 1-93 | None |
| A0A5Q4ZAC9 | 49-128 | None |
| B2T345 | 110-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.