DPCstruct | MC46459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4BPZ3 | 65-141 | DWFDTVNAGPKTDVASYTTILSHYPDISPARWIFLSDNLSEVDAARQSGMHSVPAVRPGNAPLPATHPLTEFALSEF |
| A0A7T1I6A6 | 244-314 | FDTRIGAKQRAESYRSICTELQTDPSRILFISDVTFELDAAAEAGYAVLISEREGNPPQPCHPYTSIKRFD |
| A0A2P7ZAN0 | 371-441 | None |
| A0A835JQM8 | 53-122 | None |
| A0A3M6A505 | 215-279 | None |
| A0A843URL9 | 817-898 | None |
| A0A1S3IGZ7 | 442-511 | None |
| A0A5A8CKV8 | 706-770 | None |
| A0A7R9QI05 | 398-466 | None |
| A0A438JKB5 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.