DPCstruct | MC46456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 147 ± 30 aa |
| Standard deviation of domain lengths | 29.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.35 |
| Pfam Score | 67.22 |
| Assigned Pfam label(s) | CL0344- PF09360- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0U4U7 | 153-311 | IAAGNGGGDNGVIALEGTTMKKRIYSFESDDIVVHWDALRCIHVEACIRALPDVFRRDRRPWIDPALGSADAIAAACEGCPTGALHY… |
| A0A660PX15 | 30-213 | DPKGERIPARPELWLCRCGASKNKPYCDGAHVGIKFGDEKSDDRIADRWKDYRGEKITVHDNRALCSHSGECVRGVPSVFNTEKRPW… |
| A0A538H6U3 | 18-112 | None |
| A0A2D5UI04 | 4-163 | None |
| A0A1H6C8Z8 | 192-352 | None |
| A0A3A0G5B0 | 28-222 | None |
| A0A7V5DDM7 | 2-141 | None |
| A0A843BV58 | 62-209 | None |
| A0A1E4BC61 | 18-167 | None |
| A0A846XXQ7 | 64-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.